Monday, 7 September 2026 MUMBAI EDITION LIVE

Saif Ali Khan Performs Own Action Scenes In Haiwaan

Saif Ali Khan talks about performing his own action scenes in Haiwaan. The actor found it exhausting.

Mumbai Alert · Showbiz Desk
Mumbai Alert · Showbiz Desk
Showbiz Desk · Mumbai Alert News · Mon, 07 September 2026 at 08:08 pm
Saif Ali Khan Performs Own Action Scenes In Haiwaan

Actor Saif Ali Khan is set to return to the big screen with his upcoming film Haiwaan, directed by Priyadarshan. The film's trailer has given a glimpse of Saif's character, a visually impaired man trained in martial arts.

In a recent interview, Saif opened up about shooting one of the film's most physically demanding sequences. The scene shows his character being brutally beaten and tortured before he finally fights back.

Saif explained that the sequence was particularly demanding because he performed the action without relying heavily on visual effects or body doubles. He credited stunt director Silva for choreographing the sequence and said the team wanted the fight to look as real as possible.

The actor admitted that the physical toll was greater than he had initially expected. He thought he was alright but was exhausted because the action scene was so intense. The fight scene was raw and did not use CGI or harness-backed action scenes.

Interestingly, Saif did not undergo extensive training specifically for the sequence. He had requested training ahead of the shoot, but that plan did not work out. Instead, he rehearsed some of the moves with Silva before filming.

The demanding shoot did result in some minor injuries, although Saif said the team was largely able to avoid serious accidents. He praised Silva, saying the stunt director is a master and the scene lands well in the film owing to the plot.

Haiwaan marks Saif's first collaboration with Priyadarshan. The film's plot has been kept under wraps, but the trailer has generated excitement among fans.

Saif's decision to perform his own action scenes is a testament to his dedication to his craft. The actor has been known to take on challenging roles and push himself physically in his films.

The film's action sequences are expected to be one of its major highlights. With Saif performing his own stunts, fans can expect a thrilling and realistic experience.

As the film's release approaches, fans are eagerly waiting to see Saif in action. The actor's performance in Haiwaan is highly anticipated, and his decision to perform his own stunts has generated a lot of buzz.

In conclusion, Saif Ali Khan's performance in Haiwaan is expected to be one of the film's major highlights. His decision to perform his own action scenes is a testament to his dedication to his craft, and fans can expect a thrilling and realistic experience.

The film's release is highly anticipated, and fans are eagerly waiting to see Saif in action. With its raw and intense action sequences, Haiwaan is expected to be a major hit among fans of the action genre.

Overall, Saif Ali Khan's performance in Haiwaan is a must-watch for fans of the actor and the action genre. His dedication to his craft and his willingness to push himself physically have resulted in a thrilling and realistic experience that is not to be missed.

What it means for the audience is that they will get to see a more realistic and intense performance from Saif Ali Khan. The actor's decision to perform his own stunts has added an extra layer of authenticity to the film, making it a must-watch for fans of the action genre.

Frequently asked questions

What is Haiwaan about?

Haiwaan is an upcoming film directed by Priyadarshan, starring Saif Ali Khan as a visually impaired man trained in martial arts.

Did Saif Ali Khan perform his own stunts in Haiwaan?

Yes, Saif Ali Khan performed his own action scenes in Haiwaan, without relying heavily on visual effects or body doubles.

saifalikhanhaiwaanpriyadarshanbollywoodactionmovies
X Facebook Telegram
Read the original report ↗

More in Bollywood

Bollywood

Triple H, Stephanie McMahon's $250M Net Worth Revealed

WWE power couple's fortune grows. Decades of success pay off.

By Mumbai Alert · Showbiz Desk · 1 hr ago

Bollywood

Rahul Khanna's Wholesome Breakfast At 54

Rahul Khanna shares his protein-rich breakfast plates, featuring eggs, avocado, and fresh fruits.

By Mumbai Alert · Showbiz Desk · 1 hr ago

Bollywood

Mirzapur Movie Nears ₹100 Crore Mark

Mirzapur: The Movie earns ₹93.75 crore in 3 days, set to cross ₹100 crore on Day 4.

By Mumbai Alert · Showbiz Desk · 2 hr ago

Bollywood

Rahul Roy Earns ₹2-4 Lakh Dancing At Weddings Amid Financial Struggles

Actor Rahul Roy reveals financial struggles, earns ₹2-4 lakh dancing at weddings. He suffered a brain stroke in 2020.

By Mumbai Alert · Showbiz Desk · 2 hr ago